PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang06g15460.1
Common NameLR48_Vigan02g153400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 435aa    MW: 48601.1 Da    PI: 7.2916
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang06g15460.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.42.8e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
   Vang06g15460.1 14 KGLWSPEEDEKLLRHITKYGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-28664IPR009057Homeodomain-like
PROSITE profilePS5129425.116965IPR017930Myb domain
SuperFamilySSF466895.24E-221297IPR009057Homeodomain-like
SMARTSM007172.7E-131363IPR001005SANT/Myb domain
PfamPF002493.2E-151461IPR001005SANT/Myb domain
CDDcd001676.84E-121761No hitNo description
Gene3DG3DSA:1.10.10.602.6E-1165105IPR009057Homeodomain-like
PROSITE profilePS512948.07466105IPR017930Myb domain
SMARTSM007170.6666103IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 435 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KYGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGTF SQEEENLIIE LHAVLGNRTD NEIKNLWNSC LKKKLRQKGI DPVTHKPLSE  120
VENGDDTGKS QGKAPEVSNE LNLLKSESSK SDSASYEQRT SISPKAYAPE MDGSCSSKIY  180
SRSDSNFVTN NCYNKDLFLD RFMNSSRQES YNTSCQPSDL MGTFPIQMSY ATNDCLPNDS  240
NSTHWFGQTG RPFDMNSEFP FNAATSINHP TPTTNLFLPN SFCYKPSLAV PSDSVSTAYG  300
SHYWEASASN NSNSSIRSNG STELKGSSPL NIFSSWGLAE CSTSTTKEGQ IHMMENHTEE  360
AKWDEYLHNP ISMLASVQNQ APESLCNEIK TSMHLVPDTL GAMLPHSTKQ QEPSQTSSIF  420
SKDIQKLRAA FGNM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-20121055108B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1100106LKKKLRQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150410.0AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014492385.10.0PREDICTED: transcription factor MYB86
TrEMBLA0A0L9TYY30.0A0A0L9TYY3_PHAAN; Uncharacterized protein
TrEMBLA0A0S3SQV40.0A0A0S3SQV4_PHAAN; Uncharacterized protein
STRINGGLYMA02G00960.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.35e-81myb domain protein 55
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]